fayettevilleairductcleaningandchimneysweepservice.us
Buy Now on GoDaddy
As the world’s largest domain registrar with over 20 million customers, GoDaddy manages more than 84 million domains, offering a robust platform with 24/7 customer support and a wide range of TLDs. Its user-friendly interface and comprehensive services, including hosting and website builders, make it ideal for businesses seeking an all-in-one solution.
  • Price 100 USD
  • Auction Type GoDaddy Buy Now
  • Google Status Not blocked
  • Adult Status Not adult
Domain Profile for fayettevilleairductcleaningandchimneysweepservice.us
Name Properties
  • Length 49
  • TLD us
  • Registered in TLD with links 1
  • Keyword Search Volume 0
  • Keyword CPC 0
  • Radio Test Not passed
Generic Properties
  • WHOIS Birth Date 30/06/2024
  • Wayback First Year 2024
  • Wayback Indexed Pages 2
  • Number of Wayback Crawls 4
  • Facebook Shares 0
  • Facebook Reactions 0
SEO Properties
★ ★ ★ ★ ★ 4.9 based on Thousands of domain purchaes! Trusted by Thousands of Domain Buyers Hear what our customers had to say below.
Why choose Expired Domains? Here’s what makes us a better place to start your search.
Comprehensive Listings Over 1 million domains across 677+ TLDs — updated daily.
Exclusive Data Metrics you won’t find anywhere else, built to highlight true domain value.
User-Friendly Interface Quick filtering, clean results, and zero guesswork.
Professional Trust Used by SEOs, marketers, and investors all over the world!
Why GoDaddy
GoDaddy is one of the most popular domain registries and web hosting providers in the world. As of 2023, it's the fifth-largest web host by market share, with over 62 million registered domains.
Comprehensive Domain Services GoDaddy is the world’s largest domain registrar, offering a vast selection of domain names and extensions to help you establish your online presence.
User-Friendly Website Builder GoDaddy’s intuitive website builder allows users to create professional-looking websites quickly, with customizable templates and integrated marketing tools.
Reliable Hosting with 99.9% Uptime GoDaddy provides dependable web hosting services, ensuring your website remains accessible with a 99.9% uptime guarantee and 24/7 customer support.
fayettevilleairductcleaningandchimneysweepservice.us find other domains
Buy Now on GoDaddy
★ ★ ★ ★ ★
Good for flipping or just grabbing brand names Been using ExpiredDomains for about a month and I’ve already picked up a few solid names — one of them’s already flipped. The name value and SEO price estimates are really handy. I wish the design was a bit cleaner but functionally, it’s spot on.
Anonymous Purchased on 14/03/2025
Frequently Asked Questions Your queries answered
What is ExpiredDomains.com?
ExpiredDomains.com is a free online platform that helps users find valuable expired and expiring domain names. It aggregates domain data from hundreds of top-level domains (TLDs) and displays them in a searchable, filterable format. Whether you’re seeking domains with SEO authority, existing traffic, or strong brand potential, the platform provides tools and insights to support smarter decisions.
Is there a cost to use the platform?
No, the platform is completely free to use. You can browse listings, view metrics, and apply filters without needing to sign up or pay any fees. There are no hidden charges or usage restrictions.
Can I register domains directly through the site?
No, ExpiredDomains.com does not register domains itself. Instead, it connects you to trusted external registrars and marketplaces like GoDaddy. You’ll be directed to complete your purchase or place a bid through their platform.
How often is the domain data updated?
The domain data is updated daily to ensure you're always seeing the most current listings, prices, and metrics. This includes newly expired domains, auction updates, and fresh insights from third-party tools and proprietary systems.
What tools and filters are available on the platform?
You can filter domains by TLD, keyword, length, backlink profile, SEO score, traffic estimates, and more. The platform also includes proprietary metrics like Estimated Auction Price, BrandRank, and SEO Price, alongside trusted data from sources like MOZ and Majestic.
fayettevilleairductcleaningandchimneysweepservice.us
Buy Now on GoDaddy
As the world’s largest domain registrar with over 20 million customers, GoDaddy manages more than 84 million domains, offering a robust platform with 24/7 customer support and a wide range of TLDs. Its user-friendly interface and comprehensive services, including hosting and website builders, make it ideal for businesses seeking an all-in-one solution.
Looking for something different? Search for expired domains below to find the best prices.
SOLD
Sold for
misfitgeek.com $456 USD
SOLD
Sold for
woca.net $400 USD
SOLD
Sold for
zubov.com $616 USD
SOLD
Sold for
blazepath.com $470 USD
SOLD
Sold for
lafm.com $3100 USD
SOLD
Sold for
misfitgeek.com $456 USD
SOLD
Sold for
woca.net $400 USD
SOLD
Sold for
zubov.com $616 USD
SOLD
Sold for
blazepath.com $470 USD
SOLD
Sold for
lafm.com $3100 USD
Buy Now on GoDaddy