premiercarpetcleaningftwayne.com Buy Now on GoDaddy
  • Price 395 USD
  • Auction Type Afternic Fix price
  • Google Status Not blocked
  • Adult status Not adult

Domain Profile

Name Properties

  • Length 28
  • TLD com
  • Registered in TLD with links 1
  • Keyword Search Volume 0
  • Keyword CPC 0
  • Radio Test Not passed

Generic Properties

  • WHOIS Birth Date 24/08/2019
  • Wayback First Year 2021
  • Wayback Indexed Pages 25
  • Number of Wayback Crawls 10
  • Facebook Shares 203
  • Facebook Reactions 1

SEO Properties

  • MOZ Domain Authority login
  • MOZ Page Authority login
  • Majestic External Backlinks login
  • Majestic Trust Flow login
  • Majestic Citation Flow login
  • Semrush Rank login

Similar Domains

We use cookies to ensure the proper functioning of our website. For an improved visit experience we use analysis products. These are used when you agree with "Statistics". Privacy statement

Google Analytics Create statistics data
Goal _ga, _gat, _gid, _gali
Meta Pixel (Facebook Pixel) Tracks user interactions for advertising and analytics purposes, including remarketing and conversion tracking. Cookies: _fbp, _fbc