premiercarpetcleaningftwayne.com Buy Now on GoDaddy
  • Price 395 USD
  • Auction Type Afternic Fix price
  • Google Status Not blocked
  • Adult status Not adult

Domain Profile

Name Properties

  • Length 28
  • TLD com
  • Registered in TLD with links 1
  • Keyword Search Volume 0
  • Keyword CPC 0
  • Radio Test Not passed

Generic Properties

  • WHOIS Birth Date 24/08/2019
  • Wayback First Year 2021
  • Wayback Indexed Pages 25
  • Number of Wayback Crawls 10
  • Facebook Shares 203
  • Facebook Reactions 1

SEO Properties

  • MOZ Domain Authority login
  • MOZ Page Authority login
  • Majestic External Backlinks login
  • Majestic Trust Flow login
  • Majestic Citation Flow login
  • Semrush Rank login

Similar Domains